Skip to content. | Skip to navigation

Personal tools
Log in
Sections
You are here: Home Biology Selected Sequences Sequence of Abeta(1-42) M35L

Sequence of Abeta(1-42) M35L

Notes about the sequence of the Luhrs-Riek construct.
        10         20         30         40         50         60 
MRGSHHHHHH GSNANPNANP NANPNANPNA NPNANPNANP NANPNANPNA NPNANPNANP 

        70         80         90        100        110        120 
NANPNANPNA NPNANPNANP NANPNANPRS MDAEFRHDSG YEVHHQKLVF FAEDVGSNKG 

       130 
AIIGLLVGGV VIA

Parameters computed by ExPASy Protparam:

Number of amino acids: 133
Molecular weight: 13800.6
Theoretical pI: 6.74

Ext. coefficient: 1490 M-1 cm-1, at 280 nm

Full sequence without the numbering:

MRGSHHHHHHGSNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPRSMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLLVGGVVIA

This is the non-Abeta leader from the above sequence:

MRGSHHHHHHGSNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPRSM

These are 19 NANP repeats.

See: Proc Natl Acad Sci U S A. 2005 Nov 29;102(48):17342-7.

The Abeta 1-42 M35L Sequence

    •   10     •   20     •   30     •   40
DAEFRHDSGY EVHHQKLVFF AEDVGSNKGA IIGLLVGGVV IA

The Abeta 1-42 M35L sequence without spaces:

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLLVGGVVIA